chagitqskjdlqskdmslkqdj chatjkqsdjlqskdjqslkdjkslqd azekzkjeqksldjlqsjdlsqd xqlqkzdjlqsdklqsdkslqd usr/bin/VGAuthService000075500000436060152705306200010543 0ustar00ELF>@x@p4@8 @@@@hh pp"p"4 @@"@" DDStd PtdLLL44QtdRtdpp"p" /lib64/ld-linux-x86-64.so.2GNUGNUGNUfgLB0R4^OWS# K"BEЬ!||lq8X t+qXB R M UU  Fc |1 x  % MYG' < J"-` 3sdm.V E  1 +n y e u Z[ u%-9-a ,9 A>5  ' t^A:  CQ A IwYBgQ |  $u, e 'Ihc y= ~      <: Pk4 rS Z 4 X{ gA  Hu'^ e J`Pte ?z  $}  $ @ UM E P   wd  Y " %  . d` " " " #"s  "" "4"# "0" libgthread-2.0.so.0__gmon_start___ITM_deregisterTMCloneTableg_assertion_message_expr_ITM_registerTMCloneTableg_loglibglib-2.0.so.0g_get_current_timeg_str_has_prefixg_usleepg_date_time_new_now_utcg_strrstrg_hash_table_insertg_freeg_io_channel_unrefg_main_loop_rung_key_file_get_stringg_hash_table_foreach_removeg_mutex_unlockg_realloc_ng_date_time_formatg_rw_lock_reader_lockg_path_is_absoluteg_key_file_get_keysg_key_file_load_from_fileg_key_file_get_valueg_get_current_dirg_unlinkg_malloc0_ng_hash_table_removeg_io_channel_read_lineg_rw_lock_reader_unlockg_once_implg_str_equalg_hash_table_unrefg_error_freeg_mutex_lockg_hash_table_new_fullg_rw_lock_writer_unlockg_ptr_array_newg_markup_parse_context_parseg_strstr_leng_hash_table_lookupg_utf8_casefoldg_io_add_watchg_main_loop_newg_dir_openg_date_time_unrefg_strchompg_base64_decodeg_markup_parse_context_freeg_markup_escape_textg_strcompressg_list_removeg_dir_read_nameg_base64_encodeg_mkdir_with_parentsg_hash_table_sizeg_source_set_callbackg_dir_closeg_rw_lock_initg_io_channel_unix_newg_key_file_freeg_key_file_get_booleang_set_errorg_ascii_strcasecmpg_ptr_array_addg_log_set_default_handlerg_strdupg_malloc0g_io_channel_new_fileg_ptr_array_freeg_get_host_nameg_strchugg_main_loop_quitg_mallocg_list_appendg_source_newg_filename_from_utf8g_find_program_in_pathg_vsnprintfg_strdup_printfg_time_val_from_iso8601g_source_removeg_strcmp0g_key_file_get_groupsg_str_has_suffixg_source_unrefg_strerrorg_markup_printf_escapedg_str_hashg_file_testg_list_lengthg_source_attachg_rw_lock_writer_lockg_key_file_get_integerg_timeout_add_secondsg_clear_errorg_utf8_validateg_path_get_dirnameg_strndupg_mkstempg_list_freeg_build_filenameg_source_add_pollg_date_time_get_microsecondg_markup_parse_context_newg_snprintfg_strdup_vprintfg_strlcpyg_mutex_initg_key_file_newg_strfreevlibltdl.so.7libxmlsec1.so.1xmlSecKeyDataX509GetKlassxmlSecDSigCtxVerifyxmlSecFindNodexmlSecCryptoShutdownxmlSecDSigCtxCreatexmlSecCryptoInitxmlSecNodeSignaturexmlSecDSigNsxmlSecCryptoAppInitxmlSecCheckVersionExtxmlSecCryptoAppKeysMngrCertLoadMemoryxmlSecShutdownxmlSecKeysMngrCreatexmlSecNodeX509DataxmlSecNodeKeyInfoxmlSecCryptoDLLoadLibraryxmlSecErrorsSetCallbackxmlSecKeysMngrDestroyxmlSecCryptoAppDefaultKeysMngrInitxmlSecInitxmlSecPtrListAddxmlSecCryptoAppShutdownxmlSecDSigCtxDestroyxmlSecNodeX509Certificatelibz.so.1liblzma.so.5libdl.so.2libxslt.so.1libxml2.so.2xmlFileMatchxmlFileClosexmlLoadCatalogxmlSchemaParsexmlNodeGetContentxmlStrEqualxmlSchemaSetParserErrorsxmlCheckVersionxmlSetGenericErrorFuncxmlAddIDxmlURIUnescapeStringxmlSchemaFreeValidCtxtxmlSchemaSetValidErrors__xmlLoadExtDtdDefaultValuexmlSchemaFreeParserCtxtxmlFreeDocxmlSchemaValidateDocxmlFileReadxmlRegisterInputCallbacksxmlDocGetRootElementxmlSchemaFreexmlParseMemoryxmlFreexmlFileOpenxmlGetIDxmlNodeListGetStringxmlInitParserxmlSubstituteEntitiesDefaultxmlSchemaNewValidCtxtxmlHasPropxmlSchemaNewParserCtxtlibm.so.6libssl.so.1.1OPENSSL_init_ssllibcrypto.so.1.1EVP_DigestInitX509_STORE_CTX_initX509_PUBKEY_getOPENSSL_sk_numEVP_sha256OPENSSL_init_cryptoX509_STORE_newX509_verify_cert_error_stringEVP_MD_CTX_newBIO_s_memX509_STORE_freeERR_get_error_line_dataX509_get_subject_nameX509_freeOPENSSL_sk_new_nullOPENSSL_sk_pushBIO_freeEVP_VerifyFinalPEM_read_bio_X509BIO_new_mem_bufX509_NAME_onelineX509_NAME_cmpX509_get_issuer_nameX509_STORE_CTX_newX509_STORE_CTX_get_current_certX509_printBIO_newX509_get_X509_PUBKEYX509_STORE_set_verify_cbBIO_ctrlEVP_PKEY_freeOPENSSL_sk_pop_freeEVP_DigestUpdateX509_STORE_CTX_freeX509_STORE_CTX_set0_trusted_stackX509_STORE_CTX_get_errorEVP_MD_CTX_freeERR_error_stringX509_STORE_CTX_get_error_depthX509_verify_certlibpthread.so.0acceptconnectreadwaitpidfsyncwriterecv__errno_locationsigactionsendlibc.so.6socketfflushfchmod__printf_chkexecvsetlocalestrrchrpipeftruncate64forksigprocmasksigfillset__stack_chk_faillistenabort_exitmemchrgetpidkillflockstrtolfgetsstrlensetitimeropenlogstrstrstrcspnbindchdirmemcmp__syslog_chkdup2__fxstat64__fprintf_chkgetpwuid_rfputsmemcpyfclose__vsnprintf_chkumask__lxstat64__xstat64getenvstderrsetrlimit64getpwnam_r__realpath_chkfilenochownrename__memcpy_chkstrerror_rstrchrfdopen__cxa_finalizesetsidfcntl64getrlimit64memmovefopen64__libc_start_maincloselogsysconf_edata__bss_start_endOPENSSL_1_1_0LIBXML2_2.5.8LIBXML2_2.4.30GLIBC_2.2.5GLIBC_2.28GLIBC_2.4GLIBC_2.14GLIBC_2.3.4      m 0L ui 1  mr ii  ui ti p" yx"x""""""`""p("8"H"X"h"x"""ʞ"ٞ" "( "@0 "8 "0P "؋` "h "p """""$"*"v""""""" """" 0"" " "" "("0"8"@"H"P"X" `" h" p" x" """""""""""""""""" "!"# "$("%0"&8"'@"(H")P"*X"+`",h"-p".x"/"0"1"2"3"4"5"6"7"8"9":";"<"=">"?"@"A"B"C "D("E0"F8"G@"HH"IP"JX"K`"Lh"Mp"Nx"O"P"Q"R"S"T"U"V"W"X"Y"Z"["\"]"^"_"`"a"b"c "d("e0"f8"g@"hH"iP"jX"k`"lh"mp"nx"o"p"q"r"s"t"u"w"x"y"z"{"|"}"~"""""" "("0"8"@"H"P"X"`"h"p"x""""""""""""""""""""" "("0"8"@"H"P"X"`"h"p"x""""""""""""""""""""" "("0"8"@"H"P"X"`"h"p"x""""""""""""""""""""" "("0"8"@"H"P"X"`"h"p"x"""""""""""""""""""""  " (" 0" 8"@"H"P"X"`"h"p"x"""HH!HtH5!%!hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h h% !D%!D%!D%!D%!D%!D%ݳ!D%ճ!D%ͳ!D%ų!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%ݲ!D%ղ!D%Ͳ!D%Ų!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%ݱ!D%ձ!D%ͱ!D%ű!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%ݰ!D%հ!D%Ͱ!D%Ű!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%ݯ!D%կ!D%ͯ!D%ů!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%ݮ!D%ծ!D%ͮ!D%Ů!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%ݭ!D%խ!D%ͭ!D%ŭ!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%ݬ!D%լ!D%ͬ!D%Ŭ!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%ݫ!D%ի!D%ͫ!D%ū!D%!D%!D%!D%!D%!DUH5UH=U% fAUATAH=USHHdH%(HD$1H)!H;qH;AHHt_H3HtPHrHHX!SA~mH{H5TDH=>b15HI H3L11kLHH!덿11 H=Q!H/H51H=2!H 1H<H5BH5RHH1H=&!HYH=[1H1 &1H HH5+UH'H HOHH H[HH5 H= 跨H `HaHHȯH AHrHH<$x H !HH H HHxH; 11 1 H HHEHL$dH3 %(EH[]A\A]H{H5H{H5yŅuZ11 H=.H;HHCH yH GH1aWH{H5 Ņt!H 11H'eHH5_1,H=MH=tH=HhH=\H=PH H117"f1I^HHPTLVH H=j!H=1!H*!H9tHF!Ht H=!H5!H)HHH?HHtH!HtfD=!u+UH=!Ht H=~!id!]wAWAVAUATUHSHdH%(H$1HHu1H=g1lHIE$H58HHDLLH\L-HtHpH$dH3 %(HHĸ[]A\A]A^A_HT$L&nM$K^U 1L=Iąu@f9] v/HuL1hLIHLuAT$ЃH)HHHD$8fDL{t L_u;LLH Ht8I$HL$HL<L, L4tLHHuAD$t1I$ڃHHcH1Hc؅|$ 1|$ HHH9|$ NLL pMH aH*DHDL$<11Q|$tHt$<^Hf.kH H(1D1HD$HH HD$@9@M1DH1H HDL$HĘ[]f.=!H満HH=Hc$@fo$foL$H(!foT$ fo\$0fod$@fol$P!fot$`fo|$p !Ǐ!Џ!%ُ!-!5!=!@w DŽ1fa!fDaH5SH=[Hc$@IbH5.H=LkHc$(fH111 USHdH%(H$1@!H=!Ht*H$dH3%(HĘ[]f8HŃ t)DEپIH11^@1H1CH5.H=hklfDHHHD$HzHBxHH$"mff.fATUS@ H=ԋ!L%! !HcH=!;H,Au!1H5Ƌ!O&AhH=!=H5.!X`HHH[]A\ú0H5H=XX/H5H=;881GLHI|$yt=!1 yY8H5H=ߊ! d!fq!g!HxH!!f=!1y1ۋ8BH1H1DUSH5H5n!LHCHHH=<1HHHH[]AWAVAUATUSHH $HXdH%(H$H1IH$@HHIIIEHHHT$ D$D$HLL$PIH HID$8%M=H5!H=żLH1H1蓡IH H11AH$HdH3%(LHX[]A\A]A^A_fHL$LD$HH5>IH1H1AąIH HD11A_DHL$LD$LHߺ~>IHtH5H=賻LH1H1聠@AHEI؋1H HAP1_AXf=H5H='2H1H1IH )HrkDH$ƿADžHD$PH$H9DL$8$A9DL$<$L$A9A9DL$@$L$A9A9 !u1HHHHH,HD$PHxHSHD$HUIJHIH)<HLDyeIؾ1DH 1HAH|$*QIH RH11AY^Df.H5H=bmH1H1>fHAIRH NHDHEI؋H (HP^HIH RH@DQIH RH-#HD$E1IHD$PIE "H H$1D1AIIH 1H1AfDAUMATIUHSHHHEHLD HAt&AAtvHH[]A\A]$@HcCH@HCHDL`M @HH@IHxD IH L1v@HcCHSH@HHxuH1_HcSHH RHSH\&HHfDHcCH@HCHDL`M@HH@IHxXHh1@Hh1H5H=0 H5H=HcCH@HCHDf.H5HH=]HcCH@HCHD8fATMUHSLMD Aw@H DHcH>fH5 HfD [IL]H &1A\H5H[]A\fDH5Hu[]A\fH5HaY[]A\fDH5SH9QCH{psHcHcSHCHRHDHcCH{H@H@HcCLCH@IH@-H5HHcCH@HCHDpHxnhHcHHTmHTHBHBHcSHsHRHHB@nH5H= H5UH uEHcCH@HCHTHcBHJH@H@7f*DH5Hff.AUMATIUHSHHH%HL2D HAt&AAtfHH[]A\A]@HcCHSHHTHcBHRHHTHzIH !L1HcCHHCHxuH1HcSHKHHH\H\fHcCHSHHDHxHh13fHjHcS1HHSHRDDH5 H=0ff.ATMUHSLMD AEAAt([IL]H )1A\fDH5HE1HcCHSHHDHihHcCHcHHHHCHxHT(D"HBHcSHHSHB[]A\DH5AH![]A\fDH5XH[]A\fDH59Hu}CH{ psHc#HcSHCHHDHcCHHCH@HcCHHC@HcCHHCH@mD hH5H1uU7fH5]Hu]Ad@1H5H=`H5BHqfDD LIH 1A@AWAVIAUATUSHHL$DD$LL$ dH%(HD$81HD$0HyH5z!H=HI1[LI`L#.CH5 ljD$ IHHLLH=z4LH=[CH@HDHD$(H}HjH=SH1LHH;H߉D$ D$ DE1EMfHpH=E1^ILLLD$ TD$ oH9]JHUH[H‹8HPtHH=R1IfDL1i,LHHHL$8dH3 %( HH[]A\A]A^A_HH ,Iؾ1H OH1聾HDL$ED$H5x!E1eHSH=1@HH,ÅHH5IH HH=r\LH=DL$7D$H\$ HHD HD$H;L{zHRLH=hH1LIH LD$ D$ SE1[HpH=1>LHHD$LD$D$ L-D$ xID9{BLHHC8uLH=6ȐLH=qu<@H a11H*1襼LL*HH9l$(LH=tHD$0L|DLU=LULuLL*HHD$0Ht$RLIMDH1BL-R1Ht:HH5v!H=1H茽HHlLE1HHE1LLP(HH=(MtL(MoLw(bfH11E1H=ּHHK(Iؾ1H zH[1謺H1DH 11HwHD$0L膾L'HlH'_1H 1H$LL9'HL&'>LHLLHD$0eH5`H=LIE1E1E111L蘿H1莿L膿L~fD$0裶H H1D$411DD$ DH\$0'f.D$0SH HD$4111߸LLO&H\$0DLH=QH H9\$LH=*HD$0L萾LiJLi`L%IMH茾Hc11fD$0CH HD$4f.LH=F1迹LHI$ME1LLE1${1H 1HnLL$3HT[[RH5HH=[׳[[[;H5H=舳TSHHts;wHHcH>[[H5H=?['[[H5XH=hpATUSHHHHHHHH-HArHj1E[]A\ff.f9utfD1DHHuDAVAUATE1USHH dH%(HD$1HHHt$HHjHt$HIZHT$IH;T$uHLE1MAH蟶H藶L菶L臶DHL$dH3 %(u H []A\A]A^ҵfUHSHHHñHCH}趱HCH[]ff.SHHH{[DHt'SHHH{H[صff.@ATIUSH?譵AD$~51fID$H,[HHH|(腵ID$H|(vA9\$I|$[]A\aATIUS~"GHH@HlfHHtH9u[L]A\#AVAUIATUHSHH@dH%(HD$81HD$HD$H8HWE11HT$ HH=[!HD$ HD$(肴LIwHIuSD$$EHD$(H1L芴LbH|$XHHL$8dH3 %(H@[]A\A]A^@HL$HT$LLKHuHT$Ht$HL$L菰tHD$M1H HLH1躭H|$0Ht$(|$$R;DH50H=JHH5H='蘮βff.UHSHH?;MH}~71 @H9]~&HHHuHxHH}9]H}H[]DATIUS~"GHHHl fHH dH9u[L]A\飲AUATUHSHHHdH%(HD$81HD$HD$HMHlE11HT$ HH=X!HD$ HD$(H5f!H=HI1HIXuTD$$EHD$(H1LLӱH|$ɱHHL$8dH3 %(HH[]A\A]1HL$HT$LHuHT$Ht$HL$LtHD$M1H "HLH1+H|$衩Ht$(|$$C;fD%H5H=0H&H5xH=w>ff.AWAVAUMATIUSHHHH|$HT$dH%(HD$81D$$HD$(HD$0誣zH߽腆]HT$(Ht$ LHH?D$ H|$(D$E1KD|$ H4HL4H|$()D$ ID9ɋT$HcºH,@HL4/AFI~pAvHcIJHl$(IFHcEH@HEHlAEEI}HEI}HEt$ DD$$LL$0L$LHT$(t$ jHHH G11HHt$(|$ D$H\$8dH3%(HtHH[]A\A]A^A_f.J47IDNE&1HvHIHHĠ[]A\fI1DH H(1yfAVAAUIATMUHHSHHdH%(H$1HT$ HT$HH1HutD$,D $D9cD$0T$9D$(D9MtEM1MtA$H$dH3%(Hİ[]A\A]A^11IIH H{HD$m|$,Ht$蟅HuzH|$H %DL$,I1H /Hغ1!`cIؾ1DH 1H%DD$,H Ի11H迌H|$ŒDL$,T$0D $T$HIH PHʺ11tX ZHAIPH NHDHEIPH .HϺDHIID$4H HG1P1Y^H|$ Zf.UH=SHڔHHHt"Ht|HukHޑŅtHkH[]fHxWIH 11H fIH f11H1DAIH ;1H21Ɗ^9H5mH=AUAATUSHH(HdH%(H$1 Hk#C,1ҾYAąH{fD${HsH|$lHl$軋nHD苇HsH$=H{EN1D D=Dc,1H$dH3 %(H H([]A\A]úH5H=hkH TH1D1f.膌&H{HT$ Ht$H2H{T$ t$LCH ٻHܺD_DӅHsDAcIH 11H=S;fD蓅LCH xH/D11DsfDSLCH 8HD@3H H9D11过DLCH HѹDkfLCH ź11HkKfD諄H HɹDsATI UHSHdH%(H$1Ht$HT$ D$ nHH1fG},跅xSLEAH 1H1辆A\$,1H$dH3 %(u?HĐ[]A\ۃH H1D1lSH,t諓C,[fHAUATUSHH $HH $HdH%(H$(1HHIIHHuSDA},1ɺ(H藄uH HC1艅E01"fDx9HcHHIE1I,$H$(dH3 %(u@HHHwHoHhHdHaHdHaH`H]HhATLUSEH AH |DILHcHH>f.H5HC []A\DH5MH虐C []A\DH5Hq C []A\DH5HIC []A\DH5H!u}C []A\Ð[I]H W1A\H5HfDK [IL]H 1A\骎f.H5|H葏uC H5ܵHqu]C H5HQu]CC tv}C0wfC b@H5zHuPC ?H58H C DC( @A H5H螎u C H5Hu C H5H`u C H5شHAu C H5H"u C `H5Hu C AH5Hu C "H5xHōu C H5fH覍u C H5H臍_H5HpH5&HYu C H5H:b{C iC cDDB HAH5̸DHcH>BtB B DBAtAB @B fB DBA@vH 1KH1H Q,yH5H=HGH 1H i1ЊAUHHATULSHH|DK IA H ɷDHcH>H5uL}qH5^LaUH5GLE9MH H1HL[]A\A]XDCH UA ;1 L,C$ 1L C@DCAApAH{8upLc8E1C0Z@DCArAAZC0HC8 f.DCAH{MH 5H1@DCABH{uLcE1DCH ͺA tH1蜈}DCAH{(`Lc(E1QDCH A u1 L蘃C DCH AkH5L sS DCAA H @DCAj1 LCf.DCABAH @DCAJAPH{@.Lc@E1fDCH ŸAk 1L\C@DCA nH sDHcH>fDDKEL-\'!H5̮1fIuIL蠇( uCj@H5lH=zILcE1:@H @H{ Lc E1fMH fH{8Lc8E1fC(HC0@H{0Lc0E1C(f.H @H a@H 8H HcH%!H(C9C -C HC(@H{(Lc(E1C f.H nDH ݶ8H 9,ff.ATH1UHSHHH=UyHI}H}L[]A\ATIHUSHLH=tHH1yHH}H1 HJ1|wH[]A\@HH^H@Hff.AT UHH=SHHDf1dH%(HD$1H$A9 1H=~DC1AH .H1v{ H9HHAvHHHHHu[H<$|H|HHL$dH3 %(utH[]A\fDH{HL2Ht7{H"HeHH 11HQvfsH$H=1{HJn{ff.UHXH1SH='Hv{HHPuHHHHHuH{1{HH[]ÐH 11HIdufUHSHLC(HHN VHHvHtK{H$HQHHtHHHHHu0H{HH[]fDsH=1zHfH 11H!tfUHN HSHHHVHHv;HtF{HHHH tHHH[HHu3H[zHH[]ÐsH=>1/zHf.H 11HtfAWIAVAUATUSHH(H{dH%(HD$1HT$Ht$ Hth{HԩHHHCsHLHHHHyHHL$dH3 %(H([]A\A]A^A_sH=1GyT$ HŅE1L5fDHT$KDmH=IL$H41yHtHHHHT$LB~z1@fDHPHpH=1xHtHHHHT$HL9Z~6HRH[H‹tLH=ƆsD1H=ZxHtHH:HID9l$ 1H=.*xHtHH HHt$|$ Y@HpH=1w'H ­11Hjq?CwAWAVIAUATUSHH(dH%(HD$1Ht$H|$ iHtl{HҧHHHqHLHYHHHUwHHL$dH3 %(H([]A\A]A^A_sH=Ƴ1wT$ HŅE1L-fDLHD$H=HHHpH1vHtHHHHT$HڋB~rE1<DHpH= 1vHtHHfHHT$IHD9z~1LHHBtdLH=sq뾐1H="vHtHHHID9d$ 1H=uHtHHHHt$|$ ]@H=/1u/H n11H6oGuff.@UHV(HSHHv H{dH%(HD$1H4HtX{HHfHHnHHHHHuMHuHHL$dH3 %(uPH[]sH$H=1tH<$HtDH a11H)n%tDATIUSHH H{dH%(HD$1HL$HT$HD$HD$Ht$t5Ht{HHmHHmHLH$HHH|$t1tHtH|$1HHL$dH3 %(H []A\Dl$LutvnLZt LeubsHT$1H H=ns|$HH=bnH,HHKHLtH5H=lnA1H {H1 mLȣ[MD$H 1H5H=_*kDHD$H=TH01rHtHHHHD$HHPuWHpH=ܯ1rHtHHeHH=MmHHHBHf.HH=F1/rqATUHSHHv4HtD{HH"HHkHHHIHu1HqL[]A\ÐsH=1qHf.LE1H K6H5?H=iHqL[]A\ff.AVAUATUHSHH dH%(HD$1)DEt%DEAHHI3@DEA zDHFu;¸u.A@Lkv A LeLLTdt DEA rHJcH>DuH5mH=NwYYML1HD1$>HDE1AUM1H H;jDE^_DH 11HAj}H*ILiHLHLoDEDH 1H5IC4 P1ATiXZLHL$dH3 %(IH []A\A]A^fH I11HAdiDE+tӅfDHHITDHH}I<DU$HuHLL$H}LD$H$HD$HD$) IHL$$H5BH=uW1HL1g<LD$H$H uH=]MLDHHD1xnIHD$HPHpH=1PnHtLH0IH=iHtLHILgLHHIHH<$nH|$mLm1m1mH|$ٷ@HH5IDHHIDHHIDHHIDHHItDHH]I\D}HAFIfDH51H=sUD1H1:I} LDHLIH5dH=zE1gHpH=1~l)fLCH 1H5H=dJkUHSHH Ht UlHE H]HtLDCA wHJcH>fH 11He@HkHEH[]fH{kDH{kH{k@H{kH{ kH{0}kH{8tkfH{gkH{^kH{(UkpH{GkH{>kH{0H{(,kGAUATUHSH(H_dH%(HD$1H$HD$H W11H5dK1H(1dK`1 HI1xd{ nCH0HcH>f.HKH11 7dK 1H1dHK 1H1dC(UH11cHK8H11 c@HHUHIjMHHt$dH34%(LHH([]A\A]HHt$H0M0IąHuH} HT$HL$H4$eH<$A:iEA PE1vHKHN11 b*f.Hm11H=K!HHH@HEhHE DDE4H 11HzAzbDHKH11 WbfK11H8bHK 1H1bZf.HKHؙ11 aHK1Hՙ1aC I\H 11aHKHx11 afHK11HߙL-zL%iaHK11Hę PaC L HIE11/aS$L HIE11aIfHq11`&fDHD$H Hݩ1AL@1`H|$+_HK0H 1`HK(H| 1s`Hq 11Y`HW 11?`]eDATHөAUH1S?HH_HHHE4HLEEH=ܚPH 1H5^XHZ[]A\eAV1AUATI1UH=˩SkAŅmD)I܅~_HcLDgHHtiHu\D0AtDlEH өHo11_[]A\A]A^Dhlt;[1]A\A]A^;\D0fD+\H tH=D\H \H DAWHVEAVAAUIATIULSHHMIHDHt$@HHDAQH,AU11SQ^HIEt$HLLAWH51U'bH([]A\A]A^A_ATIH1UHH S1]11HfHtEHI11H H]HfHI!Mt L[]A\fI1E1H H01n]L[]A\fDSHH$@H$HL$PL$Xt@)$`)$p)$)$)$)$)$)$dH%(H$(1H\$ ILL$H$HHD$H$0D$D$ 0HD$?_11HHqw\1HڿH5Va`H$(dH3%(u H[aAVH=!1HblAUH5#ATUSlNHHXIH 11H+ [1H51H^\1H5HH1H\HI(bAąH\LaIHH"H1Hu_LhH!HHEgH!HH1HAH+^L_H+aL#aHa[D]A\A]A^HHF11ZfDHHN11E1ZH=!1H1H5[HfH111{ZE1PH91E1ZZ*DH91E1:Z DATIUS~&GHHlf.H;H`H9u[L]A\`HH=!,H jH5 MH Hߨ1A\! 1YH=A!1HiH5M!HÐHH=!HtXH!H=!HtYH!Hff.@SH\Ht"H@HtH{@H['d1[ff.AUAATIUSH8dH%(HD$(1H8Hu2H!HL$(dH3 %(H8[]A\A]HHeŅH|$WEttHc!H,$H+l$H9~L%HAIؾATH ج11H XXAZMHH1H51[?@Hc!Hl$L%WH+,$H9fDfDIMH S1H1W ]ff.HtLUHSHHDH[0Ht'{uHsHdtHH[]H1[]1ff.AWIAVAUATUSHHHH|$ t$HL$(_`H!H5!HUHXHH!H5!HIUHwH!H5!HUHHubH@HHdHcHBLsE1MnD$ H7!DMv0MtWA~uIvHctD$ LHHcщL$%_L$IHcD$ L$ MtMv0MuT$ \$ E1{Hc_L|$8MHD$CLd$0IIK|cZIHH,LHK!HTHHA]HD$JIGM9uLLd$0L|$8'[D$HWHHH|$ ]^H5HIkXHHpHD$HI}@_HI}@HHD$ SLD$ HL$HmLd!']H{0H`kLH`DAD$ HL$AAHD$(HHU@H11S11E1HHD[]A\A]A^A_DH11SD$ HD$Ht$|$ tLYHţ11E1S11KH3_낐H I11HANSD$ HL$AHD$(H1HŞS11H11RHt$|$ E1DH11R fD11H uHR11HHRHEH5~1jVD11H 5HDR1HH5 $V,Iu@L1LD$]LD$vH11QfDHW11QHt$|$ E12DHƝ11Qff.AWAVMAUIATIUSHH(t$ PH߉C^HjHHZHH=!H7ZMtI$HtZH5HxtHHHxH52XHHUHILRLHD$ !H[H1Ll$f.H[0H{uH{H5Μ^tH5ҜH*IH8H5H]L !H{H5IHH5HM1H5L4LH5IHtW8tRZLHMIZHMHI1MH 1P1qOXZMLl$L@ !M=HD$I$HXH5HxHHzH5HN1H5H5H{H5]Ht$ LLHuuH1NY@H Q11HaNH[0HH|$vT-H11KNMuM1HZH([]A\A]A^A_H)11N11H8MMtI<$TI$fD11H&MM1fDH 111HMH11M7f1MH ,HߙcMLB!D1H1;M1DSHe11Mf.1H H[L1RDI<$1RI$H I11H9LH !11HL1H /1H3dLLC!fDH 11H4LL!H|$1RLl$H|$RHWQTQQ1H5kIH o!H!H5H=!UO`#LHxWH=WqWtl1H1GKHDHҘ11!KHHt1JHH=dX1OHVxOxA11HAH ϟ jHAJXAZ1AHH5_N1H11;J1H5(Nff.HUyLH WHcHDSLH dH%(HD$1HL$ LD$HD$D$ Ht$|$ 2 HEH\$dH3%(uH [NfDSH1H dH%(HD$1HL$ LD$HD$D$ rHt$|$  HEHt$dH34%(uH [6NfDAVIAUMATIU SLHH0dH%(HD$(1HHL$ILD$IHD$tf!Ht$|$tvHHL$MMLD$HD$C1H eIHH1GHt$|$HT$(dH3%(HuEH0[]A\A]A^)HuHt$|$rH51KMfDHH=1!1H5(IH=!Q!H@SH~@H5! Hu[LC1H 1HJG[fH=!1H5!ff.WHGHATIUHSHtUMtpXQH}HË)!PC4!HH}HCGHCEI$[1]A\H5H=ɞpGMuH5H=PGsff.HSHHH!HtHHrHS8u+CPu3H{KH{KHH[KDHPCPtHsH=.!IHt<(H5ϝH=FH !]@H5HD$H=՝[FH5H=ĝCFHD$ff.AUATIUHXSHOHHË^!PC4R!5FHHC)FH5tH=HH1~FHIJHLk¹HHu"I$HC8H[]A\A]H01H 1HDHH[]A\A]fDAUIATUSHHH=!dH%(HD$1HHGHIH$=H$Ht6L1I1H AH*CH=>!HLHHHHH<$%!HHH$HxDH=!H,$IEHdHLGHtH5H=$?DHDH=!HHD!H<$1Ht H@3BHL$dH3 %(HH[]A\A]ÐH<$tIL?MtJLH -1H5AH=&!HJ@HzCIEofDLH Θ11H5AH<$RD= 1H5,I DH=H5PCH= @H=H5(BH=a xGt1HH5Z;HH= HQH5)4 AH 11H.A ~AȺgfffAA)D H N11HH@D AfDA1Hb1@< LHHuDGHH= HiPH5i3 ~/AH ͗1wH5H=@Hw?A1H:1?p fAUIATUSH:H=b tH5H=@Ha L%2 H H-D HLH@H HH= tH5H=Gg@HHLHf@H HtrXJH=nHË C4P o@H=YXHC_@1HHC!HHI]HH[]A\A]DLH 7H5H=b<HH[]A\A]LAH H5H="}<HH[]A\A]1H 1HQ=HDff.@SHHH=~ AHt j 9 [HH5'W[@7AUATUSHHJHHtHH[]A\A]@LcH= LAHt8CPH{eu5 H߽HH[]A\A]ÿHLI>H= LH>@H5fV6HH= 1H5(>H= F H@HH~ 5B i=Hff.USHHH?kBH{bBHkHtH}PBH}'H?BHH[]1BHt'SHH?BH{H[ Bfff.@HH=q QHoH5̕.g AH 11H; : ~AȺgfffAA)DA H ^11H~HE;D AfDAQ1HR1 ;Q QLHH5 H= 1H \HtxL0@HcHHtM_1H H5H=ǔ281?HL$dH3 %(HH([]A\A]A^A_D0DLL8H(;H} HE8DuAtaHuH=V H;@ t$1i?H}:H $Hi@= 1H5Q\@ 뼿 DLt$HEII>:I~I$HEHp蝈gc>AUIH50ATI1UHSHHH= :H= H1HED$ Dd$DD$@AErH5H=0M1 H qHE/H^H51+3HD$(HD$MH $11HE1 .HH512D$ HD$(HD$'H\$(HD$0H3H8Y<l$ HcT$ 5DD$dM1H H1^.DT$dE E11L5dHD$pJ<(I ALIIH11.L49l$dH 11H̉E1 -HH511HD$(HD$:H5H=A1.PHH5 1m1HD$D$ HD$(H g11H --HFH511RH5H=ۉ6.l2f.fSP/| [f0SHtL V t:HH6HHHˉ11H[x2[fDHHm6HHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$D$0HD$dH3%(uH 1f.AWAVAUATUSH8Ll$Ld$Lt$ HL$LLdH%(HD$(1LHL$*HH DHL$LLL*HHtel$1HL|$ 7HH1UIH>1M*HL$(XZHtD$tH11*DHD$(dH3%(uH8[]A\A]A^A_0@AWAVAUATIUSHHdH%(H$14L1HHI1LH1Ƅ$LcLz6LI1LAd6AWAMATH #1UHTP1)H u2EvTL$6A1IH HY1)H$dH3 %(uYH[]A\A]A^A_AH 11HoD)fIH5;L*.ff.@H1 )1H\&ff.USHa*H5HH?-Ht@HN(HHH\-HtHhH+(HHHP2HH[]fATUSHdH%(HD$1oHHH2HHF.H4$H%HI'HH$HH|8 3foL1HHSHFICATE--HCC--- >@tH@:@tg>H@ut HHCATE----fo^LHB- fB-H-HH\$dH3%(uH[]A\fB 1Hs,ff.ATUSHHH&HHIN CERTIH3SH-----BEGH3H t^HIľL$HH111H'HHHh$L,H[]A\HFICATE--H9Cu{--- uH(If.H=ZgH5'H%H(1[H]A\@H 11H 1&XH 11H %*f.AWAVIAUATE1USHH!M&1HH[]A\A]A^A_f.AHE&H HIHAGLlfH;(HHHL1t=HL9uL&A9rVH5^H=Ѓ[&UfDH3$H ,H}11$H5 L,fDH 11H$DATE1USHdH%(HD$1H)LAHM1AUL ,Ht$H=|LLvIXZE111HHD$hLBHHLd$hH5jLHLI辀1H$H 1H} HHD$hHH H5 H= H)HD$(H$HD$ HD$xHD$HD$pHD$HL$ HT$MHt$H<$LD$hMHl$pHH<$c%i"Hl$0HHD$(HHHm7 nH/ L%0 MwI<$<LI<$HHHLLH$dH3%(HĘ[]A\A]A^A_@1HH3.HHIH1H5H=X "wfDL@1LHz1<LH=>OHLL$IL H{11H$HL$xH8 wHHʾ HHL$8)HL$8HHHHL$@H)HH$H5HHD$HpH5yHH^H5gHHD$8JH;l$8LD$Ht 8=H|$@HL$pHmz11LD$LD$LH|$pH<$"H|$(@HpIV1H5H= fDHD HD$@H5dxH=x-H5DxH=x HL$xH$H9vHT$pDHL$xHl$pHWH5wLD$@H=wHL$8LLD$@HL$8&DH=w|HI_H H5 H KH= I$fDH5twH=wlLH|$pfHxH5eLD$PKLD$P8"HD$H H|$HH5f.@USHdH%(HD$1H$1 H IHH1g1HHHH t+aHXH(HT$dH3%(uDH[]H$IH :1HyLH1 H<$p H$aSHH?@H{H[ff.AUIATIUHSHHdH%(HD$1H$HHHHL$HHt,HHT$dH3%(HuvH[]A\A]fDH$HtLHIH 11H1 H<${ LHfDH5hH=sVFfDAUAATIUHSHHdH%(HD$1H$HtiHHLHu6H$Ht-LJIH e1HJ H<$ DHt$dH34%(u+H[]A\A]H5H=H z~ff.AUAATIUHSHHdH%(HD$1H$HtiHHLHu6H$Ht-LJIH 1Hlz H<$ DHt$dH34%(u+H[]A\A]H5ЂH=ۂx zff.AWAVAUATUSHHHL'dH%(HD$81Ht$ HD$0L"LKDD$ 1HD$ H 1H́ t$ |HD$(H\$Ll$0D$ HD$SfDLHLH Z1H1e H|$0HD$0D$ HD$ ;D$  H H11 # HT$H3LLHHD$0HwL$(E1<JLMH11 I LD9|$(~xJTH3LL IHuHD$0JLHtHpLIHڀ11H JIa XZH|$0HD$0D9|$(DH11H  H H|$ HD$8dH3%(uHH[]A\A]A^A_ffDAWAVAUATUSHH $HH $Hh1H4$Ld$ HLt$HT$Ll$PdH%(H$X 1Ld$M LLHADžu HD$Hur8 u8t0SHx1Ej IH 1#XZH$X dH3 %(u/Hh []A\A]A^A_fDPH $Ht$@1L ff.AWAVAUATUSHH $HH $Hh1Ht$Ld$ Lt$Ll$PdH%(H$X 1Ld$M LL1ADžu HD$Hup8 u6t.SH1Ej AH 1 XZDH$X dH3%(u,Hh []A\A]A^A_fDH8XHL$H17 HdH%(HD$1HT$HHHL$dH3 %(uH ATUHSHH dH%(HD$1u HL$dH3 %(uVH []A\DLd$Ht$ HLHt1fHt$LHHu1ҋD$9D$ C AVAUATUHSLI1Iw@E11L5&~H|LHI9v-|\uEuHXAD1[]A\A]A^DfAVAUATUSHH $HH $HH$IIALLɾdH%(H$ 1HHƄ$ H1EPM1LUH}SH H$ dH3%(uH []A\A]A^ ff.HLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0HD$dH3%(uHJ f.AUIATAUHSHHLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IMD8H$HHHD$HD$ HD$$ D$0HD$dH3%(uH[]A\A]jf.AUATUSHH $HAHIHL$PL$Xt@)$`)$p)$)$)$)$)$)$dH%(H$(1H\$ HL$H$HD$ HD$H$0D$ 0HD$ H11H{EMHƄ$' SXZH$(dH3%(uH[]A\A]<ff.AUATUSHH $HAHIHL$PL$Xt@)$`)$p)$)$)$)$)$)$dH%(H$(1H\$ HL$H$HD$ HD$H$0D$ 0HD$ H11HyEMHƄ$'SXZH$(dH3%(uH[]A\A] ff.AUATUSHH $HAHIHL$PL$Xt@)$`)$p)$)$)$)$)$)$dH%(H$(1H\$ HL$H$HD$ HD$H$0D$ 0HD$ H11HxEMHƄ$'SXZH$(dH3%(uH[]A\A]f.fPXH xx1Hʚ;@UHSH(dH%(HD$1HiH]H;$HT$dH3%(u H([]Off.@PX1HIAѾH x1HL1H x6H5wW ATUSHHHHHHHH HA>H6D[]A\f.@ATUSHdH%(HD$1H IąHH5iw1HH=lwH1HHH$H<$H5RwT tPH<$H5Gw@ tpath != NULLmaxOldLogFilesmaxLogSize%s: failed to dup stderr to logfile ServiceFileLogger_InitServiceFileLoggerOpenProcessing SIGHUP %s: condition: %d gio.c%s: about to stop main loop %s END SERVICE%s: main loop has exited%s: failed to clone a new connection Established a new pipe connection %d on %sProcessing SIGTERM; service exiting ServiceIOMainLoopServiceIOAcceptGSourceServiceIOAcceptServiceEndMainLooperrorcriticalwarningmessagedebugunknownno time%FT%T%s.%03dZ[%s] [%8s] [%s] %s resettingenableCoreDumpsCore dump limit set to %denableLoggingnormalloglevelverboseFailed to set core dump size limit, error %d (%s) %s: Unable to set up file logger %s: Unrecognized loglevel '%s' VGAuthService%s '%s' logging at level '%s' Service_InitLogging%s bad pid %d read; skipping servicePosix.cargspath%s: Couldn't fork, error %d. //dev/nullpidPathFd >= 0%ld %s: failed to open pid file '%s', error %u %s: sending SIGTERM to service at pid %d %s: pid %d not found, returning success %s: kill(%d) failed, error %u %s: Couldn't open PID path [%s], error %u. %s: Lock held on PID path [%s], error %u, not daemonizing. %s: Couldn't create pipe, error %u. %s: Couldn't set close-on-exec for fd %d, error %u. %s: Couldn't fork first child, error %u. %s: Child %d exited with error %d. %s: Child %d exited with signal %d. %s: Child could not exec %s, read %d, error %u. %s: Couldn't create new session, error %d. %s: Couldn't chdir to /, error %u. %s: Couldn't write to parent pipe: %u, original error: %u. %s: Couldn't truncate path [%s], error %d. %s: Couldn't write PID to path [%s], error %d. %s: Couldn't flush PID to path [%s], error %d. %s: Couldn't exec %s, error %d. ServiceDaemonizeServiceSuicideSignal source: reading from wake up fd failed.Too many signals queued, this shouldn't happen. Could not queue signal %d (error %d: %s) signum != SIGKILL && signum != SIGSTOPCannot set signal handler: %s signalSource.cnbytes == sizeof infoinfo.si_signo < MAX_SIGNALSFALSEsignum < MAX_SIGNALSuser-%s/%s%s%s%s: lstat(%s) failed (%d %d) root%s: fstat(%s) failed (%d %d) ../serviceImpl/alias.clistinfosuserAliasesaliaspemCertificatealiasInfosaliasInfosubjectanySubjectcommentmappingsmappingsubjectsuserName%s/%sXXXXXX%s: fdopen() failed (0 == num) || (NULL != aList)%s: fputs() failed %s: fflush() failed %s: fsync() failed %s: fclose() failed mapping.xml%s/%s %s %s.bak%s: trying to restore files %s: failed to restore %s idx <= nummaList%s: no such user '%s' %s: failed to save Aliases %s: Illegal user name '%s' maList[userIdIdx].num >= 0ANYallowSymlinksaliasStoreDirsuffix%s.bad%s: size of %s too large %d; failing read @&!*@*@(alias.mapping.badfile)Mapping file '%s' exists but is not a regular file. The Aliases in the mapping file will not be available for authentication%s: mapping file %s exists but isn't a regular file, punting @&!*@*@(alias.mapfile.badperm)Alias store mapping file '%s' has incorrect owner or permissions. The Aliases in the mapping file will not be available for authentication@&!*@*@(alias.alias.badfile)Alias store '%s' exists but is not a regular file. The Aliases for user '%s' will not be available for authentication%s: file %s exists but isn't a regular file, punting @&!*@*@(alias.alias.badperm)Alias store '%s' has incorrect owner or permissions. The Aliases for user '%s' will not be available for authentication%s: failed to open %s for read (%d) %s: size of %s changed (%d vs %d) %s: mode of %s changed (%d vs %d) %s: uid of %s changed (%d vs %d vs %d) %s: gid of %s changed (%d vs %d vs %d) %s: realpath() failed. errno (%d) %s: Real path (%s) is not same as file path (%s) %s: failed to read from file %s (%d) Unexpected contents '%s' in parse state %dUnexpected element '%s' in parse state %d%s: removed empty alias file '%s' %s %s %s %s %s: removed empty map file '%s' %s %s %s: alias store file %s exists but isn't a regular file, punting %s: map file %s exists but isn't a regular file, punting %s: Unable to parse contents of '%s': %s %s: client tried to add a duplicate subject '%s' for user '%s' %s: client tried to add a duplicate mapping entry for subject '%s' and cert '%s' @&!*@*@(alias.addid)Alias added to Alias store owned by '%s' by user '%s'%s: alias added with Subject '%s'@&!*@*@(alias.removeid)Alias removed from Alias store owned by '%s' by user '%s'%s: all aliases removed for requested username%s: alias removed with Subject '%s'%s: failed to load Aliases for '%s' %s: failed to load mapped aliases /var/lib/vmware/VGAuth/aliasStoreUsing '%s' for alias store root directory @&!*@*@(alias.dir.badperm)Alias store directory '%s' has incorrect owner or permissions. Any Aliases currently stored in '%s' will not be available for authentication%s: failed to open alias store %s: %s @&!*@*@(alias.alias.renamefail)Failed to rename suspect Alias store '%s' to '%s'@&!*@*@(alias.alias.rename)Suspect Alias store '%s' renamed to '%s'%s: alias store had invalid contents @&!*@*@(alias.dir.notadir)Alias store directory '%s' exists but is not a directory%s: Failed to load alias for user '%s' %s: orphaned mapped alias: user %s subj %s cert %s @&!*@*@(alias.dir.renamefail)Failed to rename suspect Alias store directory '%s' to '%s'%s: failed to set up Alias store directory tree 8#$($8$8$####$$$l$l$t$t$l$ServiceValidateAliasesServiceIDVerifyStoreContentsServiceAliasInitAliasStoreServiceAliasQueryMappedAliasesServiceAliasQueryAliasesServiceAliasRemoveAliasAliasSafeRenameFilesAliasDumpMappedAliasesFileAliasDumpAliasesAliasSaveAliasesAndMappedAliasLoadMappedServiceLoadFileContentsPosixAliasLoadAliasesServiceAliasAddAlias%s: g_rename(%s, %s) failed (%d) g_unlink(%s) failed../serviceImpl/file.cServiceFileUnlinkFileServiceFileRenameFileg_mkstemp(%s) failed../serviceImpl/filePosix.c%s: chown() failed, %d %s: chmod() failed, %d Failed to change ownership of %s%s: Unable to look up userinfo to change ownership of '%s' to '%s' %s: g_lstat() failed on '%s', %d %s: g_mkdir_with_parents(%s, 0%o) failed (%d) %s: Unable to look up userinfo of '%s' to check ownership of '%s' %s: Unable to look up userinfo of '%s' to check ownership of '%s', but found valid entry for uid %d %s: username '%s' lookup failed, but found uid %d -- temp NIS outage? %s: failed to look up uid %d; assuming user is deleted or NIS is inaccessible %s: uid mismatch for %s (want %d, found %d) %s: gid mismatch for %s (want %d, found %d) %s: file permission mismatch for %s (want 0%o, found 0%o) ServiceFileVerifyFileOwnerAndPermsServiceFileGetPermissionsServiceFileSetPermissionsServiceFileMakeDirTreeServiceFileCopyOwnershipServiceFileSetOwnerServiceFilePosixMakeTempfile/var/run/vmware/guestServicePipe%s: socket dir path '%s' already exists as a non-directory; canceling %s: failed to create socket dir '%s' error: %d %s: Created socket directory '%s' strlen(conn->pipeName) < UNIX_PATH_MAX%s: unlink(%s) failed, %d - continuing %s: failed to get uid/gid for user '%s' %s: got new connection on '%s', sock %d %s: error %d reading from socket %s: asked to send %d bytes; bad caller? ../serviceImpl/netPosix.csocketDir != NULL%s: socket() failed, %d %s: bind(%s) failed, %d %s: stat(%s) failed, %d %s: chmod(%s) failed, %d %s: chown(%s) failed, %d %s: fcntl() failed, %d %s: listen() failed, %d %s: accept() failed, %d %s: EOF on socket %s: send() failed, errno %d ServiceNetworkWriteDataServiceNetworkReadDataServiceNetworkAcceptConnectionServiceNetworkListenServiceNetworkCreateSocketDirUNKNOWNSESSIONCONNECTADDALIASREMOVEALIASQUERYALIASESQUERYMAPPEDALIASESCREATETICKETVALIDATETICKETREVOKETICKETVALIDATE_SAML_BEARER_TOKENINVALIDrequestNamesequenceNumberversionticketaddMappedLinkpemCertpidtokensamlTokenvalidateOnlyhostVerifieduserHandleInfouserHandleTypesamlInfosamlSubject../serviceImpl/proto.cSessionRequestFound username in req type %dFound ticket in req type %dFound SUBJECT in req type %dFound comment in req type %dFound pemCert in req type %dFound pid in req type %dFound token in req type %dnamePasswordsspisamlsamlInfoOnlyReturning error message '%s' sessionRequest failedaddAlias failedremoveAlias failedqueryAliases failed%squeryMappedIds failed%screateTicket failedvalidateTicket failedrevokeTicket failedSecurity check failedvalidateSamlToken failedUnrecognized requestTRUEcomplete: %d sequenceNumber: %d requestType: %d(%s REQ) version #: %d userName: '%s' userName: %s addMapped: %d pemCert: %s Subject: %s ANY Subject *** UNKNOWN Subject type *** comment: %s userName '%s' ticket '%s' token '%s' username '%s' validate Only '%s' hostVerified '%s' ConnectAddAliasRemoveAliasQueryAliasesQueryMappedAliasesCreateTicketValidateTicketRevokeTicketValidateSamlBTokenBBBCC C0C@CPC`CpCCDdDdDdDdDdDdDdDCdDdDdDdDdDdDDDdDCGGYGYGYGYGYGYGGxGhGHGHGYGYGYGYGGGGYGYGPLHIKKKJK@KHhK I`IIIJHJH@JhJHLILVIVIVILVILLI\^mZD^,^^]]]d\L\|\____`__ `___4dbta`$cctab,b,bcServiceReplyTooManyConnectionsProto_FreeRequestServiceProtoRevokeTicketProtoValidationTypeStringServiceProtoValidateTicketServiceProtoCreateTicketServiceProtoQueryMappedAliasesServiceProtoQueryAliasesServiceProtoRemoveAliasServiceProtoAddAliasServiceProtoHandleConnectionServiceProtoHandleSessionRequestServiceProtoValidateSamlBearerTokenProto_SecurityCheckRequestServiceProtoDispatchRequestServiceProtoReadAndProcessRequestBad parse state, popping aliasInfo in req type %dBad parse state, popping pemCert in req type %dBad parse state, popping (any)subject state %dBad parse state, popping unknown parse state %dTrying to handle new request of type %s when processing a request of type %dFound version number in req type %dFound addMappedLink in req type %dFound ANYSUBJECT in req type %dFound SAML token in req type %dFound validateOnly option in req type %dFound hostVerified option in req type %dFound userHandle type in req type %dFound unrecognized userHandle type %sFound samlSubject in req type %d%d%Lu%s%s: version mismatch. Client is %d, want %d sessionRequest failed; version mismatch%d1%s%s: failed to send SessionReq reply %d%s%s: failed to send Connect reply %d%s: failed to send AddSubject reply %s: failed to send RemoveAlias reply %d%s%s%s%s: failed to send QueryAliases reply %s%s%d%s%s: failed to send CreateTicket reply %s: Tried to convert a validationType of %d to a string %d%s%s%s%sServiceNetWorkWriteData() failed, pipe = %s@&!*@*@(proto.attack)Possible security attack! Request type %d has a userName (%s) which doesn't match the pipe owner (%s)!%s: Possible security attack! Request type %d has a userName (%s) which doesn't match the pipe owner (%s)! %s: Unrecognized request type '%d' %s: security check failed for request type %d @&!*@*@(validate.samlBearer.fail)Validation of SAML bearer token failed: %d@&!*@*@(validate.samlBearer.success)Validated SAML bearer token for user '%s'%d%s%s%s%s: processed reqType %d(%s REQ), returning %Lu on connection %d %s: trying to free unknown request type %d %s: read EOF on Connection %d %s: g_markup_parse_context_parse() failed: %s No Subject type specified (assuming removeAll case) Unknown request type -- no request specific data The user exceeded its max number of connectionsUser %s exceeding concurrent connection limit of %d connections (connection ID is %d)/dev/urandom%s: read error: %d %s: Failed to close: %d %s: Failed to open random device: %d ServiceRandomBytes%s: Failed to open file "%s" %s: Opening file "%s" XML Error: %ssamlSchemaDirschemas..catalog.xmlsaml-schema-assertion-2.0.xsdclockSkewAdjustmentallowUnrelatedCertsis not yet validhas expiredMissing signature node Missing KeyInfo node Missing x509 node Failed to create key managerFailed to init key manager PEM cert: %s Failed to register ID Signature verify failed No Subject node found NameIDSubjectConfirmationMethod%s: method %s not bearer SubjectConfirmationDataNotBeforeNotOnOrAfterRecipient%s: failed recipient check Conditions%s: Time Conditions failed! ConditionFailed to verify Conditions Failed to verify Signature Failed to parse document Failed to load schemas xmlSecInit() failed %d opensslxmlSecCryptoInit() failed %d XMLSec Error: %s:%s(line %d) object %s subject %s reason: %d, msg: %s%s: Incoming file name is "%s" %s: Using '%s' for SAML schemas Error: catalog file not found at "%s" Error: Failed to load catalog at "%s" Failed to create schema parser context Error: Failed to parse schemas Failed to create schema validation context %s: Allowing %d of clock skew for SAML date validation %s: Could not parse %s value (%s). %s: FAILED SAML assertion (timeStamp %s, delta %d) %s. Missing x509 certificate node(s) Missing x509 certificate base64 data %s: Failed to add cert to key manager Failed to add cert to key manager %s: token is hostVerified, skipping signature checkFailed to limit allowed key data %s: Signature is invalid (got %d) %s: signature is invalid (got %d) Failed to validate doc against schema Failed to validate token against schema %s: NameID not found in Subject %s: Missing SubjectConfirmation method urn:oasis:names:tc:SAML:2.0:cm:bearer%s: subjConfirmData time check failed %s: audience check: token: '%s', host: '%s' ? %d Failed to verify Subject node %s: No Conditions found, accepting %s: Unrecognized condition found! Error: xmlsec1 lib version mismatch Error: unable to load openssl xmlsec-crypto library. Make sure that you have xmlsec1-openssl installed and check shared libraries path (LD_LIBRARY_PATH) environment variable. xmlSecCryptoAppInit() failed %d %s: Using xmlsec1 %d.%d.%d for XML signature support Unrelated certs found in SAML token, failing %s: ServiceVerifyAndCheckTrustCertChainForSubject() returned %Lu SAML_VerifyBearerTokenAndChainVerifyConditionsCheckAudienceCheckTimeAttrVerifySubjectBuildCertChainVerifySignatureLoadPrefsLoadCatalogAndSchemaUserXmlFileOpenSAML_Init%s: removing old listen conn for user %s %s: failed to setup private listen channel %s: Already have a connection for user '%s', but the user check failed, so tearing down the connection and trying to rebuild g_hash_table_lookup(listenConnectionMap, userName) == NULL%s: removing dead userConn for %s from hashtable%s: removing failed userConn for %slistenTTL set to invalid value of %d, using default of %d instead %s: listen conn TTL set to %d seconds %s: computed reapCheckTime as %d seconds maxDataConnectionsPerUser set to invalid value of %d, using default of %d instead Maximum number of data connections per user set to %dFailed to initialize the listen connection mapFailed to initialize the data connection map%s: failed to setup public listen channel ../serviceImpl/service.cparentclonestopListeningIOFuncpCountpCount > 0listenConnectionMaplistenTTLmaxDataConnectionsPerUserlistenConnectionMap == NULLdataConnectionMap == NULLServiceInitDataConnectionPrefsServiceInitListenConnectionPrefsServiceListenHashRemoveCheckServiceStartUserConnectionServiceCreateUserConnectionServiceCreatePublicConnectionticketTTLTicket-%s-%s../serviceImpl/ticket.cticketTTL set to invalid value of %d, using default of %d instead %s: ticket TTL set to %d seconds TicketGenerateTicket() failed, user = %sServiceCreateTicketInfoServiceInitTicketPrefs../serviceImpl/verify.csubjnumCerts > 0%s: Token chain cert #%d: %s%s: User '%s' doesn't exist %s: User doesn't exist %s: Store chain cert #%d: %s%s: no matching cert and subject found in mapping file %s: no mapping entries or specified userName %s: found more than one user in map file chain %s: %d certs in store for user %s %s: No trusted certs in chain %s: cert chain validation failed %s: cert chain successfully validatedmatchIdIdx >= 0 && matchSiIdx >= 0ServiceVerifyAndCheckTrustCertChainForSubject%s.SSL error: %lu (%s) in %s line %d %s: name: %s ok: %d error '%s' (%d) at %d depth lookup:%s %s: error '%s' (%d) treated as failure %s: unable to convert string to BIO %s: unable to convert string to x509 %s: failed to create X509 stack %s: failed to convert PEM cert to X509 %s: failed to add cert to stack sk_X509_num(chain) == numCerts%s: out of memory creating BIO %s: failed to convert untrusted chain %s: failed to convert trusted chain %s: unable to create x509 store %s: unable to create x509 store context %s: unable to init x509 store context %s: unable to verify x509 certificate (ret = %d) %s: unable to allocate a message digest. %s: unrecognized hash algorithm %d. %s: unable to initialize verificatation context (ret = %d) %s: unable to update verificatation context (ret = %d) %s: error while verifying signature (ret = %d) %s: failed to convert PEM cert to X509. %s: unable to get the public key from the cert. %s: failed to convert cert to X509 %s: unrelated cert subject: %s %s: Success! no unrelated certs found %s: %d unrelated certs found in list SSL error data: %s %s: allowing error %d --../common/certverify.c-----BEGIN CERTIFICATE----- %s: verification failed! CertVerify_CheckForUnrelatedCertsCertVerify_CheckSignatureCertVerify_CheckSignatureUsingCertPEMChainToStackVerifyCallbackCertVerify_CertChainCertVerifyX509ToStringCertStringToX509-----BEGIN CERTI-----END CERTIFI../common/i18n.cbufmsgState == NULLcatalogdomainLANGC%s: user locale=%s %s%smessages%s%s%s%s.vmsglocalPath != NULLUnable to open '%s': %s myValuevaluedomain != NULLmsgid != NULL@&!*@*@XMsgHasMsgID(msgid)len <= MSG_MAX_ID - 1%s: Using LANG override of '%s' %s: loading message catalog '%s' Unable to read a line from '%s': %s Couldn't parse line from catalog: %sInvalid UTF-8 string in message catalog (key = %s) Cannot load message catalog for domain '%s', language '%s', catalog dir '%s'. MsgLoadCatalogMsgGetUserLanguageI18n_BindTextDomain%s: Using '%s' as preferences filepath %s: g_key_file_load_from_file(%s) failed: %s %s: Pref_GetString(%s) failed: %s %s: Pref_GetInt(%s) failed: %s %s: Pref_GetBool(%s) failed: %s %s: %d preference groups in file '%s' %s: g_key_file_get_keys(%s) failed: %s %s: g_key_file_get_value(%s:%s) failed: %s ../common/prefs.ckeyFile%s: End of preferences Group '%s' %s=%s Pref_LogAllEntriesPref_GetBoolPref_GetIntPref_GetStringPref_Init%s: getpwnam_r(%s) failed %d (%d), try #%d %s: getpwuid_r(%d) failed %d (%d), try #%d <>/\UsercheckLookupUidUsercheckLookupUser[function %s, file %s, line %d], %s, [errno = %d], %s [function %s, file %s, line %d], %s Hang the calling thread../common/VGAuthUtil.cAssertion '%s' failed at %s:%d Util_Assertguest.log.text%s [vgauthservice] %sdisabledUnknown command%s: RPC unknown or disabled %s: failed to send RPC packet %s: Error sending RPC, assume they aren't supported %s: new RPC Failed, using old SendLogStringVMXLog_LogV%s: Failed to set up VMX logging %s: couldn't get VMCI address family %s: bind() failed w/ ADDRINUSE, trying another port %s: failed to find a bindable port %s: bind() worked for port %d %s: connect() failed with RESET, trying another port %s: connect() RESET %d times, giving up %s: failed to create VMCI socket %s: failed to build RPC packet %s: failed to send packet (%d) %s: failed to read reply length (wanted %d, got %d) (%d) %s: failed to read reply packet (%d) %s: socket() failed %d %s: bind() failed %d %s: connect() failed %d %s: reply len: %u %s: reply len too small (%u) %s: unexpected EOF, failing CreateVMCISocketVMXRPC_SendRpcVMXRPC_Init;0nd %ԐLĘ0Dltԛ4ԝ0X$tD( ġ< dl   , @ l Գ $  Ľ( 4d  44 ` T T DT|D TPxD0tDt(TD$lT4 T(d<dDDp  $ T 4 h4  8t4Txd""#l$4%T&,d(l()d))+0t+h168H8`8x88d99;,T;D;d;x;;<==>`A$AB4BDBBDtDEEE $F, tFT Fp G G I JL!DK!K!K!U"U0"UD"TVh"W"X"Y@#YX#$Z#T[#\#]<$^p$$_$b$c %dl%g%g&h&dh4&tq&s't0'tL'u'v'tw(yd(z({,)4|H)||)T})$~*~8*t**+Dd+t+ԃ+$++4(,T<,dP,d,d,, -dT-zRx /D$4HhFJ w?:*3$"\ y<t(FBK A(G@ (A ABBA HBBB B(A0D8G 8A0A(B BBBH 8wFEA E(J0 (D ABBH ,<В-EHD  DAF lГWHN(8EMS0v AAC ,HR4EATE$lCEAG qCA(&QTDHV\7HnHtؖFBB B(A0A8F`U 8A0A(B BBBE zRx `(t, EMM@P AAG 0<FHD DP  AABJ `p<FEE B(D0C8Gj 8A0A(B BBBD [MA 3(EDNL AAK (< EAGW AAJ 0hFAA  ABA $IAAD }DAبJBBB B(A0A8G L# 8A0A(B BBBC #d#H#B##K#\#A#K #G#U I #W#H D #K#Q A #K#L 8hFED D(G0t (D ABBI P8FDD V GPM ^ ABG Z ABC ^ ABG 8eFED D(G0t (D ABBI P4ȲFDD s GPP  ABF ^ ABG ^ ABG L BBE B(A0A8D 8A0A(B BBBD (ZBDC \ AOK (RBDC S ASH 80,Er I G I T L G I G I G I 0lEj A G I T L G I G I (SBAA HDBP+@lFBB D(A0GP 0A(A BBBA $$5EDG bAALEQh1JY((_FDA LAB(\=FDA gDB@pBBE A(D0Gp 0A(A BBBE $ kEDD WAA(H D=FDA gDB8t XBBA D(Gp (A ABBH L `FBB E(D0A8G 8A0A(B BBBK L FBB B(D0D8Gp 8A0A(B BBBK @P LFDD s ABD c ABB fAB IE^ E `\ FIB B(A0A8D1LZA 8A0A(B BBBG @ hWFDD N ABA I(^0H(C AAB0X UEDD O CAH hCA4 FDD \ ABC g ABA 0 FDD G0O  AABH ( EGOa AAB @$ WFDD N ABA I(^0H(C AABh @EN E g0 FGI GE  AABJ | 0FEE D(G0O 0A(A BBBD KVFQ GU D GU D`HA(< P-EHD h CAC <h T`FEA A(JB (A ABBA 0 tFID G  AABI  EX $ @  (FBA A(G L@LP (A ABBA `P FEE D(D0k (F BBBA A (C BBBF `(C BBBxtDFDA T ABF _ ABF _ ABF _ ABF [ ABB A DUF e GPT @@o8XFHA D(G0 (D ABBM (9BFD iAB(\BKA JAB%H\0RFFK G0  AABG (8D~EMK | DAB (dEDK X DAG (EHG U DAB H=FEB B(A0A8G` 8A0A(B BBBD H1FBE B(A0A8G`~ 8A0A(B BBBH (TEHG0v AAD 0FEE E(D0F8DP] 8D0A(B BBBC L<P?FBE B(A0A8DP 8D0A(B BBBE A3DnzRx j"AKHBABEY J | (B FBB E(A0A8JGbGuH\AzGbA 8A0A(B BBBE L JbFBB E(A0A8J> 8A0A(B BBBE ( LEAD0 AAD !|M"EX8!MFED D(D@\ (A ABBG 8X!DNFED D(D@ (A ABBD 8!NFED D(D@ (A ABBD `!lO:FBB B(A0A8GCgAi 8A0A(B BBBA `4"HQFBB B(A0A8G L@IAoANAWAAAh 8A0A(B BBBG `"R FBB B(A0A8G L@IAiANAWAAAf 8A0A(B BBBG "RHH z A 0#RFAD G@t  AABF <L#PSwFBB A(D0T (A BBBF \#SBBB A(A0G L@I@T@F@I@M@I@Z 0A(A BBBA #TK A 8$TFED D(J (A ABBA LD$8U$FBA A(G L""b"F"A"Z (A ABBA L$V$FBA A(G L""b"F"A"Z (A ABBA L$V$FBA A(G L""b"F"A"Z (A ABBA 4%W,EAM(P%WQEDF@w DAA |% XIEA](%TXRFAA FAB0%XBAA D0  AABG %Z &Z & Z(4&(ZK A T&Z|LJ J g Q `x&4[FBE B(A0A8D 8A0A(B BBBG dHAD&`eFEE E(H0H8G@n8A0A(B BBB$'a yx"`pʞ ٞ y       1 r Q qp"x"o0 " "hp8 4P oo03oo0o@"R R0R@RPR`RpRRRRRRRRRSS S0S@SPS`SpSSSSSSSSSTT T0T@TPT`TpTTTTTTTTTUU U0U@UPU`UpUUUUUUUUUVV V0V@VPV`VpVVVVVVVVVWW W0W@WPW`WpWWWWWWWWWXX X0X@XPX`XpXXXXXXXXXYY Y0Y@YPY`YpYYYYYYYYYZZ Z0Z@ZPZ`ZpZZZZZZZZZ[[ [0[@[P[`[p[[[[[[[[[\\ \0\@\P\`\p\\\\\\\\\]] ]0]@]P]`]p]]]]]]]]]^^ ^0^@^P^`^p^^^^^^^^^__ _0_@_P_`_p_________`` `0`@`P```p`````````aa a0a@aPa`apaaaaaaaaabb b0b@bPb`bpbbbbbbbbb|@0؋,QGA$3a1Qox GA$3p1113sqGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*sj GA*GOW*GA$3a1pxq GA$3p1113~8qGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*@qq GA*GOW* GA*FORTIFY0y,kGA+GLIBCXX_ASSERTIONS GA*FORTIFY~qGA+GLIBCXX_ASSERTIONSVGAuthService-12.3.5-2.el8_10.2.x86_64.debug~m7zXZִF!t/1 :]?Eh=ڊ2N}۬`?# E=%@r=:3.ag-2KnODٌjxqZ{v @? ND7j11` VƼhGrz)1L } Jjwڦ_!7њ7w Ј~3%2/)T3{_'/ƹ`y?kBŝh/{A !TA =o푷j|=nTHu.Z̳nӱ;́T`1ia(X#-g䛆Hǘ# )1IO72Gk";J]ndծ6?V*b _6An\B<^vCXQԕ".2p$k}41u<273DGm0j*!=wiy t#F莏KEI E.J$ms.PA:CW- _(M'rހK*7Q&EBioh\|HS{:J D!\mĬ"!8n,T Q~-N U,cT_޴M1>Ss?5ݭڵp He,v[֑uxʸI5Q5I:MY28$ 5D3$U[^q5#:ܴ8w&`7WukGv:5S`J] #Ϫnj>by(XMH%xцX&OIm@l:U>}XL&Z1pQ/9$eߴ;ɭ?}(r yޟU?ixjؒ'_&`@6j8gs.hvl4w\O+iRDUwCaV^q_pgBxK{J4{,MƤN~(#T3ܡ|q/q]w1aZ$< C 2N.4C1!y%)/D!&,)dq\cߠiNnugP=X>I'@5uV:*3AnG1.@/M?cg; J)rqU~`Fr󿦸ұp ]%R @ag}V\ 1͖ <P Z<+4ym1=wiڣ7 n3gR"& l842,Q9Kv=b ȼ :Q?3wQaKYԔ}!򜲳+'lVu! 5mb>ȓ(0fm@5F"ZwǠd !XD4Es#M/ہOUx(EqJ`T|MZw>7L=3 Kl?M(,+qԂmy0̸ Cz6G9rW>^TCs]WXdvB{ 邏H.@Ŗ>{dOs/L+"};4O17D@y8ȒIE"|ѭ<*tZ0΁ˠ*~.fed޾Cb<8M `h;u(Ja?j2g6M|"+rO$ڤi,%L7}T[e,-~&?_=F=)α ܼ]?2I=,5RYJ`LWIYLc\:LSVR!8Œsȯ#mze6܀:]?d<,+G Jrl'R2Oͦw"%@"YI2+N3'}-9>SV+|ڈޠ!ҝTYj8,p$+n"OG4b"z QqϷ^|j[ ϝg=)/nO8y_Ӆa^Hm^tRNۆ"6hHF̪xI6ؖI ]'maQt4t[%7ӘjrKU5)ri$M)-R*w/?_j40)-f3b.J~!iO`sVY'S/tG~=0RPxH+\߬x 8\x